Return to main results Retrieve Phyre Job Id

Job DescriptionP0A937
Confidence8.13%DateThu Jan 5 11:09:18 GMT 2012
Rank53Aligned Residues41
% Identity20%Templated1vkea_
SCOP infoAhpD-like AhpD-like CMD-like
Resolution1.56

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10.........20.........30.........40.........50.........
Predicted Secondary structure 
























Query SS confidence 

























































Query Sequence  RCKTLTAAAAVLLMLTAGCSTLERVVYRPDINQGNYLTANDVSKIRVGMTQQQVAYAL
Query Conservation 
   
          




      
  

 

  
    
  
  



 

  

Alig confidence 






















.................

















Template Conservation 
 



 


     
  

  
.................   
   
 
 


 
 
Template Sequence  KTKELMGLVASTVLRCDDCIRYH. . . . . . . . . . . . . . . . . LVRCVQEGASDEEIFEAL
Template Known Secondary structure  TT
.................TT

Template Predicted Secondary structure 


.................



Template SS confidence 

























































   44.....50.........60...... ...70.........80....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions