Return to main results Retrieve Phyre Job Id

Job DescriptionP0A937
Confidence16.02%DateThu Jan 5 11:09:18 GMT 2012
Rank18Aligned Residues36
% Identity17%Templatec4a1cO_
PDB info PDB header:ribosomeChain: O: PDB Molecule:rpl19; PDBTitle: t.thermophila 60s ribosomal subunit in complex with2 initiation factor 6. this file contains 5s rrna,3 5.8s rrna and proteins of molecule 4.
Resolution3.52 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   13......20.........30.........40.........50.........
Predicted Secondary structure 























Query SS confidence 














































Query Sequence  LLMLTAGCSTLERVVYRPDINQGNYLTANDVSKIRVGMTQQQVAYAL
Query Conservation      




      
  

 

  
    
  
  



 

  

Alig confidence 








...........


























Template Conservation 


 

  
...........  





     
  
 

  

 

Template Sequence  LAASVLKCG. . . . . . . . . . . QKRLWLDPNESSEISMANSRASIRKLI
Template Known Secondary structure  TS
...........GGG
STT

S
Template Predicted Secondary structure 


...........





Template SS confidence 














































   10........ .20.........30.........40.....
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions