Return to main results Retrieve Phyre Job Id

Job DescriptionP0A937
Confidence11.10%DateThu Jan 5 11:09:18 GMT 2012
Rank34Aligned Residues36
% Identity19%Templatec3iz5T_
PDB info PDB header:ribosomeChain: T: PDB Molecule:60s ribosomal protein l19 (l19e); PDBTitle: localization of the large subunit ribosomal proteins into a 5.5 a2 cryo-em map of triticum aestivum translating 80s ribosome
Resolution5.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   13......20.........30.........40.........50.........
Predicted Secondary structure 























Query SS confidence 














































Query Sequence  LLMLTAGCSTLERVVYRPDINQGNYLTANDVSKIRVGMTQQQVAYAL
Query Conservation      




      
  

 

  
    
  
  



 

  

Alig confidence 








...........


























Template Conservation 


 

 

...........  





     
  
 

  

 

Template Sequence  LASSVLKCG. . . . . . . . . . . KGKVWLDPNEVNEISMANSRQNIRKLV
Template Known Secondary structure  TS
...........TTT
SSS

S
Template Predicted Secondary structure 


...........





Template SS confidence 














































   10........ .20.........30.........40.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions