Return to main results Retrieve Phyre Job Id

Job DescriptionP0A937
Confidence7.08%DateThu Jan 5 11:09:18 GMT 2012
Rank64Aligned Residues37
% Identity19%Templatec3beyC_
PDB info PDB header:structural genomics, unknown functionChain: C: PDB Molecule:conserved protein o27018; PDBTitle: crystal structure of the protein o27018 from methanobacterium2 thermoautotrophicum. northeast structural genomics consortium target3 tt217
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   910.........20.........30.........40.........50.........
Predicted Secondary structure 























Query SS confidence 


















































Query Sequence  AAAVLLMLTAGCSTLERVVYRPDINQGNYLTANDVSKIRVGMTQQQVAYAL
Query Conservation          




      
  

 

  
    
  
  



 

  

Alig confidence 












..............























Template Conservation 

 


    

 .............. 
   
   

  
 
 


 
 
Template Sequence  LISVACSVAVRCD. . . . . . . . . . . . . . ACTRRHAEEALEAGITEGELAEAA
Template Known Secondary structure  TT
..............TT

Template Predicted Secondary structure 


..............



Template SS confidence 


















































   3940.........50. ........60.........70.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions