Return to main results Retrieve Phyre Job Id

Job DescriptionP0A937
Confidence18.26%DateThu Jan 5 11:09:18 GMT 2012
Rank12Aligned Residues41
% Identity7%Templatec2qeuA_
PDB info PDB header:lyaseChain: A: PDB Molecule:putative carboxymuconolactone decarboxylase; PDBTitle: crystal structure of putative carboxymuconolactone decarboxylase2 (yp_555818.1) from burkholderia xenovorans lb400 at 1.65 a resolution
Resolution1.65 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10.........20.........30.........40.........50.........
Predicted Secondary structure 
























Query SS confidence 

























































Query Sequence  RCKTLTAAAAVLLMLTAGCSTLERVVYRPDINQGNYLTANDVSKIRVGMTQQQVAYAL
Query Conservation 
   
          




      
  

 

  
    
  
  



 

  

Alig confidence 






















.................

















Template Conservation 
 



 


     
  

  
.................   
   
 
 


 


Template Sequence  KYKHLILVVLDAIRDEPIGIVNH. . . . . . . . . . . . . . . . . TRAAXNAGLSVDELIEGI
Template Known Secondary structure  T
.................TT

Template Predicted Secondary structure 


.................



Template SS confidence 

























































   65....70.........80....... ..90.........100.....
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions