Return to main results Retrieve Phyre Job Id

Job DescriptionP52599
Confidence57.94%DateThu Jan 5 12:05:49 GMT 2012
Rank88Aligned Residues43
% Identity19%Templatec3dlmA_
PDB info PDB header:transferaseChain: A: PDB Molecule:histone-lysine n-methyltransferase setdb1; PDBTitle: crystal structure of tudor domain of human histone-lysine n-2 methyltransferase setdb1
Resolution1.77 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   252.......260.........270.........280.........290.........300.........310.........320..
Predicted Secondary structure 



































Query SS confidence 






































































Query Sequence  KETQLTDVRIGQSVNIISDLYGENVVFHGRVTGINMGTGNAFSLLPAQNATGNWIKIVQRVPVEVSLDPKE
Query Conservation   
 

  
  

 
 
  

        
 
  
 
                          
 
 
    
Alig confidence 

















....















........................








Template Conservation 
 



  
 

 
  
 .... 
 
    
  

 

........................
 
 
    
Template Sequence  PNRPMVLLKSGQLIKTEW. . . . EGTWWKSRVEEVDGSL. . . . . . . . . . . . . . . . . . . . . . . . VRILFLDDK
Template Known Secondary structure  T







TT
....TTTT........................TTTT
Template Predicted Secondary structure 







....



........................



Template SS confidence 






































































   152.......160......... 170.........180..... ....190....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions