Return to main results Retrieve Phyre Job Id

Job DescriptionP0A8M6
Confidence4.29%DateThu Jan 5 11:08:12 GMT 2012
Rank86Aligned Residues26
% Identity27%Templatec2qnfB_
PDB info PDB header:hydrolase/dnaChain: B: PDB Molecule:recombination endonuclease vii; PDBTitle: crystal structure of t4 endonuclease vii h43n mutant in2 complex with heteroduplex dna containing base mismatches
Resolution3.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   32.......40. ........50.......
Predicted Secondary structure  ..........




Query SS confidence 









. . . . . . . . . .















Query Sequence  EKKIRDNQKR. . . . . . . . . . VLLLDNLSDYIKPGMS
Query Conservation 









..........






  



 

Alig confidence 









..........















Template Conservation 

 
     
 
      
    
     

  
  
Template Sequence  EGQMKHKFNRSGLKGQGVDYLEWLENLLTYLKSDYT
Template Known Secondary structure  SSGGGGT

S

T
Template Predicted Secondary structure 











Template SS confidence 



































   65....70.........80.........90.........100
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions