Return to main results Retrieve Phyre Job Id

Job DescriptionP0AB67
Confidence20.03%DateThu Jan 5 11:14:45 GMT 2012
Rank169Aligned Residues35
% Identity31%Templatec3ej9D_
PDB info PDB header:hydrolaseChain: D: PDB Molecule:beta-subunit of trans-3-chloroacrylic acid dehalogenase; PDBTitle: structural and mechanistic analysis of trans-3-chloroacrylic acid2 dehalogenase activity
Resolution1.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   316...320.........330.........340.........350.........360.
Predicted Secondary structure 












Query SS confidence 













































Query Sequence  GMAVAQAQYPVAEITEKLRARGINVRFGIHPVAGRLPGHMNVLLAE
Query Conservation 







  
 

   
   
  
 



















Alig confidence 

















...........
















Template Conservation 


 

  

 



 

...........  










   
Template Sequence  GLSVARKQQLIRDVIDVT. . . . . . . . . . . NKSIGSDPKIINVLLVE
Template Known Secondary structure 


...........


GGG
Template Predicted Secondary structure  ...........




Template SS confidence 













































   10.........20....... ..30.........40....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions