Return to main results Retrieve Phyre Job Id

Job DescriptionP0AB67
Confidence62.68%DateThu Jan 5 11:14:45 GMT 2012
Rank61Aligned Residues58
% Identity21%Templatec2an1D_
PDB info PDB header:transferaseChain: D: PDB Molecule:putative kinase; PDBTitle: structural genomics, the crystal structure of a putative kinase from2 salmonella typhimurim lt2
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   326...330.........340.........350.........360.........370.........380.........390......... 400...
Predicted Secondary structure 




























..



Query SS confidence 









































































. .



Query Sequence  VAEITEKLRARGINVRFGIHPVAGRLPGHMNVLLAEAKVPYDIVLEMDEINDDFADTDTVLVIGANDTVNPAAQ. . DDPK
Query Conservation 
 

   
   
  
 




















 



   





  
  
















 .. 

 
Alig confidence 






















.........................

























..



Template Conservation     
   
   

 
 
      .........................         



 





 
 
        
Template Sequence  HEMLYRWLCDQGYEVIVEKVPTG. . . . . . . . . . . . . . . . . . . . . . . . . TLAEIGQQADLAVVVGGDGNMLGAARTLARYD
Template Known Secondary structure  TT




B
.........................

SSTTSS
Template Predicted Secondary structure 







.........................












Template SS confidence 















































































   23......30.........40..... ....50.........60.........70.......
 
   404....
Predicted Secondary structure 




Query SS confidence 




Query Sequence  SPIAG
Query Conservation 


 
Alig confidence 




Template Conservation   



Template Sequence  INVIG
Template Known Secondary structure 
Template Predicted Secondary structure 

Template SS confidence 




   88.90..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions