Return to main results Retrieve Phyre Job Id

Job DescriptionP0AB67
Confidence70.98%DateThu Jan 5 11:14:45 GMT 2012
Rank59Aligned Residues54
% Identity30%Templatec1z0zC_
PDB info PDB header:transferaseChain: C: PDB Molecule:probable inorganic polyphosphate/atp-nad kinase; PDBTitle: crystal structure of a nad kinase from archaeoglobus2 fulgidus in complex with nad
Resolution2.85 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   326...330.........340.........350.........360.........370.........380.........390.........400....
Predicted Secondary structure 

































.
Query SS confidence 














































































.
Query Sequence  VAEITEKLRARGINVRFGIHPVAGRLPGHMNVLLAEAKVPYDIVLEMDEINDDFADTDTVLVIGANDTVNPAAQDDPKS.
Query Conservation 
 

   
   
  
 




















 



   





  
  
















  

 
.
Alig confidence 
















.............................
































.
Template Conservation     
   
         .............................           
 

 





 
 
        
Template Sequence  VKRIEEALKRLEVEVEL. . . . . . . . . . . . . . . . . . . . . . . . . . . . . FNQPSEELENFDFIVSVGGDGTILRILQKLKRCP
Template Known Secondary structure  TTT
.............................SS

GGGGGSSSSTT
SS

Template Predicted Secondary structure 


.............................















Template SS confidence 















































































   13......20......... 30.........40.........50.........60...
 
   405...
Predicted Secondary structure 



Query SS confidence 



Query Sequence  PIAG
Query Conservation 

 
Alig confidence 



Template Conservation 



Template Sequence  PIFG
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 



   64...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions