Return to main results Retrieve Phyre Job Id

Job DescriptionQ46920
Confidence10.14%DateThu Jan 5 12:35:53 GMT 2012
Rank39Aligned Residues35
% Identity23%Templatec3kkaD_
PDB info PDB header:transferaseChain: D: PDB Molecule:ephrin type-a receptor 2; PDBTitle: co-crystal structure of the sam domains of epha1 and epha2
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   64.....70.........80.........90.........100.........110.........120.
Predicted Secondary structure 



















Query SS confidence 

























































Query Sequence  WLNAKGLPQVAVGHVELDYTSVNLIESKSFKLYLNSFNQTRFNNWDEVRQTLERDLST
Query Conservation 

   
 

   
 
 
   
   













   
     
   
  


 
Alig confidence 








.......................

























Template Conservation 

  


  .......................
   
    

    
  
   

  
Template Sequence  WLESIKMQQ. . . . . . . . . . . . . . . . . . . . . . . YTEHFMAAGYTAIEKVVQMTNDDIKR
Template Known Secondary structure  TTT
GG.......................GTT

STT

Template Predicted Secondary structure 


.......................





Template SS confidence 

























































   912.......920 .........930.........940......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions