Return to main results Retrieve Phyre Job Id

Job DescriptionP77611
Confidence24.34%DateThu Jan 5 12:31:03 GMT 2012
Rank244Aligned Residues41
% Identity29%Templatec3l51A_
PDB info PDB header:cell cycleChain: A: PDB Molecule:structural maintenance of chromosomes protein 2; PDBTitle: crystal structure of the mouse condensin hinge domain
Resolution1.51 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   251........260.........270.........280.........290.........300.......
Predicted Secondary structure 




























Query SS confidence 
























































Query Sequence  LTYILTGKQVPHGGRSSDIGVLMQNVGTAYAVKRAVIDGEPITERVVTLTGEAIARP
Query Conservation 

    
   
    
   
  
 

 
   
  
   
 
   
 


 
     
Alig confidence 








...........











....















.



Template Conservation      


  ........... 

 

  
  
....          





.

 
Template Sequence  GXEFVFGTT. . . . . . . . . . . FVCNNXDNAKKV. . . . AFDKRIXTRTVTLGGD. VFDP
Template Known Secondary structure  TT
...........SS....
TTT


TTS
.

Template Predicted Secondary structure 

...........

....






.

Template SS confidence 
























































   619620....... ..630......... 640.........650..... ....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions