Return to main results Retrieve Phyre Job Id

Job DescriptionP77611
Confidence23.84%DateThu Jan 5 12:31:03 GMT 2012
Rank248Aligned Residues45
% Identity18%Templatec2wd5B_
PDB info PDB header:cell cycleChain: B: PDB Molecule:structural maintenance of chromosomes protein 3; PDBTitle: smc hinge heterodimer (mouse)
Resolution2.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   249250.........260.........270.........280.........290.........300.........310
Predicted Secondary structure 





























Query SS confidence 





























































Query Sequence  KQLTYILTGKQVPHGGRSSDIGVLMQNVGTAYAVKRAVIDGEPITERVVTLTGEAIARPGNV
Query Conservation    

    
   
    
   
  
 

 
   
  
   
 
   
 


 
     
   
Alig confidence 










...........













......



















Template Conservation        


  ........... 

  
  
  
  ......      






    
 
Template Sequence  DKAFKHVFGKT. . . . . . . . . . . LICRSMEVSTQLAR. . . . . . AFTMDCITLEGDQVSHRGAL
Template Known Secondary structure  TT...........SS......SS

TT


TTS
Template Predicted Secondary structure 

...........

......









Template SS confidence 





























































   619620......... 630.........640... ......650.........660...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions