Return to main results Retrieve Phyre Job Id

Job DescriptionP77611
Confidence24.66%DateThu Jan 5 12:31:03 GMT 2012
Rank243Aligned Residues31
% Identity23%Templatec2jr7A_
PDB info PDB header:metal binding proteinChain: A: PDB Molecule:dph3 homolog; PDBTitle: solution structure of human desr1
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   375....380.........390.........400.........410.........420.....
Predicted Secondary structure 





















Query SS confidence 


















































Query Sequence  QSCIRCSACADACPADLLPQQLYWFSKGQQHDKATTHNIADCIECGACAWV
Query Conservation    

 

 
   

  
 
                      
 


 
  
Alig confidence 


.







...................



















Template Conservation 


.



 
 
...................

 





 

 
 



 
Template Sequence  YPC. PCGDNFSI. . . . . . . . . . . . . . . . . . . TKEDLENGEDVATCPSCSLI
Template Known Secondary structure 
.TTSS...................T


TTT

Template Predicted Secondary structure 
.



...................








Template SS confidence 


















































   24.. ...30.... .....40.........50....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions