Return to main results Retrieve Phyre Job Id

Job DescriptionP76004
Confidence6.86%DateThu Jan 5 12:17:15 GMT 2012
Rank56Aligned Residues28
% Identity21%Templatec1gxcA_
PDB info PDB header:phosphoprotein-binding domainChain: A: PDB Molecule:serine/threonine-protein kinase chk2; PDBTitle: fha domain from human chk2 kinase in complex with a2 synthetic phosphopeptide
Resolution2.7 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   150.........160.........170.........180.........190....
Predicted Secondary structure 



















Query SS confidence 












































Query Sequence  LSVNGEQRQQGTTADMIHKIVPLIAYMSKFFTLKAGDVVLTGTPD
Query Conservation    



  
      
      


 

   

 




 



 
Alig confidence 














.................












Template Conservation 
 


  
       .................
  

 
 

   
Template Sequence  TFVNTELVGKGKRRP. . . . . . . . . . . . . . . . . LNNNSEIALSLSR
Template Known Secondary structure  TT

TT
.................

TTSSTT
Template Predicted Secondary structure 









.................







Template SS confidence 












































   168.170.........180.. .......190.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions