Return to main results Retrieve Phyre Job Id

Job DescriptionP76004
Confidence35.43%DateThu Jan 5 12:17:15 GMT 2012
Rank23Aligned Residues47
% Identity13%Templatec1gr3A_
PDB info PDB header:collagenChain: A: PDB Molecule:collagen x; PDBTitle: structure of the human collagen x nc1 trimer
Resolution2.0 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   145....150.........160.........170.........180.........190.........200.........210
Predicted Secondary structure 



























Query SS confidence 

































































Query Sequence  NTTLSLSVNGEQRQQGTTADMIHKIVPLIAYMSKFFTLKAGDVVLTGTPDGVGPLQSGDELTVTFD
Query Conservation   
 
   



  
      
      


 

   

 




 



 
   
  

 
 
 

Alig confidence 























...................






















Template Conservation     
 
 

               ...................   

 
 

 
  

 
 
 
 
Template Sequence  HVWVGLYKNGTPVMYTYDEYTKGY. . . . . . . . . . . . . . . . . . . LDQASGSAIIDLTENDQVWLQLP
Template Known Secondary structure  TT

BTTB...................

TT


Template Predicted Secondary structure 









...................





Template SS confidence 

































































   609610.........620.........630.. .......640.........650.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions