Return to main results Retrieve Phyre Job Id

Job DescriptionP0AE76
Confidence86.84%DateThu Jan 5 11:22:43 GMT 2012
Rank203Aligned Residues56
% Identity23%Templatec3pfiB_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:holliday junction atp-dependent dna helicase ruvb; PDBTitle: 2.7 angstrom resolution crystal structure of a probable holliday2 junction dna helicase (ruvb) from campylobacter jejuni subsp. jejuni3 nctc 11168 in complex with adenosine-5'-diphosphate
Resolution2.69 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3......10.........20.........30.........40.........50.........60.........70.........80.
Predicted Secondary structure 






























Query SS confidence 














































































Query Sequence  ILVTGGARSGKSRHAEALIGDSSQVLYIATSQILDDEMAARIEHHRQGRPEHWRTVERWQHLDELIHADINPNEVVLLE
Query Conservation   










  

 

       



    
 

  

  

  
   
 
 
    
             



Alig confidence 


































......................










.









Template Conservation 


 







 

  

                ......................    
      .     

 

Template Sequence  ILFSGPAGLGKTTLANIISYEXSANIKTTAAPXIE. . . . . . . . . . . . . . . . . . . . . . KSGDLAAILTN. LSEGDILFID
Template Known Secondary structure  SSTTSSTT

GGG

......................SST.

TT
Template Predicted Secondary structure 










.......................




Template SS confidence 














































































   55....60.........70.........80......... 90.........100 .........110
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions