Return to main results Retrieve Phyre Job Id

Job DescriptionP37691
Confidence21.34%DateThu Jan 5 11:57:13 GMT 2012
Rank115Aligned Residues45
% Identity29%Templated1n0wa_
SCOP infoP-loop containing nucleoside triphosphate hydrolases P-loop containing nucleoside triphosphate hydrolases RecA protein-like (ATPase-domain)
Resolution1.70

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   147..150.........160.........170.........180.........190.........200.........210.
Predicted Secondary structure 



















Query SS confidence 
































































Query Sequence  LYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLARRNGSTIAIGHPH
Query Conservation 





 

  


   
   


   






     

  

  
  



 
 






 
Alig confidence 








....................



































Template Conservation   





  ....................
                 
  

      

     
Template Sequence  LLIVDSATA. . . . . . . . . . . . . . . . . . . . LYRELSARQXHLARFLRXLLRLADEFGVAVVITNAH
Template Known Secondary structure  TSSG....................GG






Template Predicted Secondary structure 
....................












Template SS confidence 
































































   218.220...... ...230.........240.........250.........260..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions