Return to main results Retrieve Phyre Job Id

Job DescriptionP52135
Confidence4.30%DateThu Jan 5 12:05:40 GMT 2012
Rank73Aligned Residues25
% Identity20%Templatec3fz5C_
PDB info PDB header:isomeraseChain: C: PDB Molecule:possible 2-hydroxychromene-2-carboxylate isomerase; PDBTitle: crystal structure of possible 2-hydroxychromene-2-carboxylate2 isomerase from rhodobacter sphaeroides
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   87..90.........100.........110.........120
Predicted Secondary structure 




















Query SS confidence 

































Query Sequence  TVVMDHKQYAIPSTLGWRNGDNAWFSFIMDIRKA
Query Conservation     

   
  
  
  
 
 

   

  



Alig confidence 









.........














Template Conservation 



 
    .........
 

       
   
Template Sequence  FFLVDDEPFW. . . . . . . . . GWDRXEXXAEWIRTG
Template Known Secondary structure  TT.........SGGGT
Template Predicted Secondary structure 

.........






Template SS confidence 

































   173......180.. .......190.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions