Return to main results Retrieve Phyre Job Id

Job DescriptionP60955
Confidence2.37%DateThu Jan 5 12:07:16 GMT 2012
Rank53Aligned Residues24
% Identity21%Templated1kxpd1
SCOP infoSerum albumin-like Serum albumin-like Serum albumin-like
Resolution2.10

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   237..240.........250.........260.........
Predicted Secondary structure 








Query SS confidence 
































Query Sequence  AFRIIVEFFRQPDAQFTGAWVQYISMGQILSIP
Query Conservation    

 


 
 
           

  
  

 
Alig confidence 













.........









Template Conservation     



 




 .........
    

  
Template Sequence  ANQFMWEYSTNYGQ. . . . . . . . . APLSLLVSYT
Template Known Secondary structure  STT.........S
Template Predicted Secondary structure 


.........

Template SS confidence 
































   156...160......... 170.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions