Return to main results Retrieve Phyre Job Id

Job DescriptionP25960
Confidence48.18%DateThu Jan 5 11:42:47 GMT 2012
Rank13Aligned Residues22
% Identity14%Templatec2jneA_
PDB info PDB header:metal binding proteinChain: A: PDB Molecule:hypothetical protein yfgj; PDBTitle: nmr structure of e.coli yfgj modelled with two zn+2 bound.2 northeast structural genomics consortium target er317.
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   41........50.........60.........70.
Predicted Secondary structure 
















Query SS confidence 






























Query Sequence  LVHFRQKKYAWHDTVPLILCVAAAIACALAP
Query Conservation   
  
   
    



 
 
   



 
 
Alig confidence 











.........









Template Conservation   

 

  
   .........     
  
 
Template Sequence  HCPQCQHVLDQD. . . . . . . . . NGHARCRSCG
Template Known Secondary structure  B
SSS
SB.........TTTTT
Template Predicted Secondary structure 







.........


Template SS confidence 






























   4.....10..... ....20.....
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions