Return to main results Retrieve Phyre Job Id

Job DescriptionP0AG20
Confidence50.72%DateThu Jan 5 11:27:53 GMT 2012
Rank157Aligned Residues29
% Identity17%Templatec3u1nC_
PDB info PDB header:hydrolaseChain: C: PDB Molecule:sam domain and hd domain-containing protein 1; PDBTitle: structure of the catalytic core of human samhd1
Resolution3.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   56...60....... ..70...... ...80....
Predicted Secondary structure  ...........



....

Query SS confidence 











. . . . . . . . . . .








. . . .







Query Sequence  LWRGVEMVEILS. . . . . . . . . . . TLSMDIDTL. . . . RAALLFPL
Query Conservation 
 


 

 


........... 
  
  

.... 





 
Alig confidence 











...........








....







Template Conservation 






 


      
        
       
 







Template Sequence  FEHSLGVGYLAGCLVHALGEKQPELQISERDVLCVQIAGLCHDL
Template Known Secondary structure 
GGG


TTT
Template Predicted Secondary structure 








Template SS confidence 











































   165....170.........180.........190.........200........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions