Return to main results Retrieve Phyre Job Id

Job DescriptionP0AG20
Confidence29.76%DateThu Jan 5 11:27:53 GMT 2012
Rank219Aligned Residues68
% Identity13%Templatec3pvpA_
PDB info PDB header:dna binding protein/dnaChain: A: PDB Molecule:chromosomal replication initiator protein dnaa; PDBTitle: structure of mycobacterium tuberculosis dnaa-dbd in complex with box22 dna
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   50.........60.........70.........80.........90.........100.........110.........120.........
Predicted Secondary structure 




















Query SS confidence 















































































Query Sequence  PDASLLLWRGVEMVEILSTLSMDIDTLRAALLFPLADANVVSEDVLRESVGKSVVNLIHGVRDMAAIRQLKATHTDSVSS
Query Conservation   





 


 

 


 
  
  

 





 



  
   
   

  

 

 




                
Alig confidence 


















.................
































.....





Template Conservation    
   
  

 




 
.................     
   

  







  
  

     ..... 
  
 
Template Sequence  PGKTRALAQSRQIAMYLCR. . . . . . . . . . . . . . . . . ELTDLSLPKIGQAFGRDHTTVMYAQRKILSEMA. . . . . ERREVF
Template Known Secondary structure  S


.................



TT

.....
Template Predicted Secondary structure 








.................





.....
Template SS confidence 















































































   434.....440.........450.. .......460.........470.........480..... ....490.
 
   130.........
Predicted Secondary structure 
Query SS confidence 









Query Sequence  EQVDNVRRML
Query Conservation   


  



Alig confidence 









Template Conservation    
  
   
Template Sequence  DHVKELTTRI
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 









   492.......500.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions