Return to main results Retrieve Phyre Job Id

Job DescriptionP0AG20
Confidence54.69%DateThu Jan 5 11:27:53 GMT 2012
Rank149Aligned Residues29
% Identity21%Templatec3bg2A_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:dgtp triphosphohydrolase; PDBTitle: crystal structure of deoxyguanosinetriphosphate triphosphohydrolase2 from flavobacterium sp. med217
Resolution1.95 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   56...60.........70... .... ..80....
Predicted Secondary structure 



........................

Query SS confidence 

















. . . . . . . . . . . . . . . . . . . . . .



. .






Query Sequence  LWRGVEMVEILSTLSMDI. . . . . . . . . . . . . . . . . . . . . . DTLR. . AALLFPL
Query Conservation 
 


 

 


 
  
 ...................... 

 ..





 
Alig confidence 

















......................



..






Template Conservation 







 


 
   
                        






 


Template Sequence  LTHSLEVSVVGRSLGRMVGKKLLEKYPHLEQVYGYKFNDFGAIVAAAALAHDI
Template Known Secondary structure  STTT


TTT
Template Predicted Secondary structure 
















Template SS confidence 




















































   66...70.........80.........90.........100.........110........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions