Return to main results Retrieve Phyre Job Id

Job DescriptionP0AG20
Confidence63.78%DateThu Jan 5 11:27:53 GMT 2012
Rank131Aligned Residues29
% Identity31%Templatec2o6iA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:hd domain protein; PDBTitle: structure of an enterococcus faecalis hd domain phosphohydrolase
Resolution2.55 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   56...60......... 70.........80....
Predicted Secondary structure 
....................




Query SS confidence 













. . . . . . . . . . . . . . . . . . . .














Query Sequence  LWRGVEMVEILSTL. . . . . . . . . . . . . . . . . . . . SMDIDTLRAALLFPL
Query Conservation 
 


 

 


 
....................  
  

 





 
Alig confidence 













....................














Template Conservation 






  

      
                     
  






Template Sequence  FSHSLGVYEITRRICEIFQRNYSVERLGENGWNDDERLITLCAALLHDV
Template Known Secondary structure  SBGGGSB
GGGTTT
Template Predicted Secondary structure 











Template SS confidence 
















































   64.....70.........80.........90.........100.........110..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions