Return to main results Retrieve Phyre Job Id

Job DescriptionP32696
Confidence1.28%DateThu Jan 5 11:50:18 GMT 2012
Rank92Aligned Residues25
% Identity20%Templatec3mbgC_
PDB info PDB header:flavoproteinChain: C: PDB Molecule:fad-linked sulfhydryl oxidase alr; PDBTitle: crystal structure of human augmenter of liver regeneration (alr)
Resolution1.85 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   55....60.. .......70.........
Predicted Secondary structure  .......










Query SS confidence 







. . . . . . .
















Query Sequence  IAVVWVIK. . . . . . . AIKAPKVPKYQRYDRWR
Query Conservation   
 


 
.......           

   
Alig confidence 







.......
















Template Conservation     


   

 

 




 
 
     

 
Template Sequence  AFTQWLCHLHNEVNRKLGKPDFDCSKVDERWR
Template Known Secondary structure  TT




GGGT
Template Predicted Secondary structure 







Template SS confidence 































   165....170.........180.........190......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions