Return to main results Retrieve Phyre Job Id

Job DescriptionP32696
Confidence3.77%DateThu Jan 5 11:50:18 GMT 2012
Rank24Aligned Residues27
% Identity30%Templatec2l2tA_
PDB info PDB header:membrane proteinChain: A: PDB Molecule:receptor tyrosine-protein kinase erbb-4; PDBTitle: solution nmr structure of the erbb4 dimeric membrane domain
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   36...40.........50.........60........
Predicted Secondary structure 



Query SS confidence 
































Query Sequence  FLGGMLALMIKLLPWLLLAIAVVWVIKAIKAPK
Query Conservation   
 

  
 

 



 

 
 


 
      
Alig confidence 













......












Template Conservation 


 

  


 
 ...... 

  







Template Sequence  VIGGLFILVIVGLT. . . . . . FAVYVRRKSIKKK
Template Known Secondary structure  ......TT
SS

Template Predicted Secondary structure  ......
Template SS confidence 
































   57..60.........70 .........80...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions