Return to main results Retrieve Phyre Job Id

Job DescriptionP76550
Confidence15.32%DateThu Jan 5 12:24:27 GMT 2012
Rank58Aligned Residues29
% Identity31%Templated1fpoa2
SCOP infoOpen three-helical up-and-down bundle HSC20 (HSCB), C-terminal oligomerisation domain HSC20 (HSCB), C-terminal oligomerisation domain
Resolution1.80

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   100........ .110.........120........
Predicted Secondary structure  .........
Query SS confidence 








. . . . . . . . .



















Query Sequence  MELREAVAE. . . . . . . . . RDAIIDDLKARIAELEAALA
Query Conservation 








.........



















Alig confidence 








.........



















Template Conservation 

 

 



    
   
  
  
           
 
Template Sequence  LELREELDEIEQAKDEARLESFIKRVKKMFDTRHQLMV
Template Known Secondary structure  T
Template Predicted Secondary structure 



Template SS confidence 





































   96...100.........110.........120.........130...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions