Return to main results Retrieve Phyre Job Id

Job DescriptionQ46899
Confidence7.13%DateThu Jan 5 12:35:39 GMT 2012
Rank55Aligned Residues25
% Identity24%Templatec2dzlA_
PDB info PDB header:structural genomics unknown functionChain: A: PDB Molecule:protein fam100b; PDBTitle: solution structure of the uba domain in human protein2 fam100b
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   229230......... 240.........250...
Predicted Secondary structure 

........



Query SS confidence 










. . . . . . . .













Query Sequence  NINLAQLQENL. . . . . . . . GGASREQALEIATH
Query Conservation   

   
  

........

 
   
      
Alig confidence 










........













Template Conservation 




 

 













 








Template Sequence  SVNMDELRHQVMINQFVLAAGCAADQAKQLLQA
Template Known Secondary structure  S





T
Template Predicted Secondary structure 


Template SS confidence 
































   910.........20.........30.........40.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions