Return to main results Retrieve Phyre Job Id

Job DescriptionQ46793
Confidence8.64%DateThu Jan 5 12:34:14 GMT 2012
Rank63Aligned Residues25
% Identity28%Templatec2h0dB_
PDB info PDB header:metal binding protein/ligaseChain: B: PDB Molecule:ubiquitin ligase protein ring2; PDBTitle: structure of a bmi-1-ring1b polycomb group ubiquitin ligase complex
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   186...190.........200.........210.......
Predicted Secondary structure 





Query SS confidence 































Query Sequence  CEQYLINNHCFSPDKVNEICEQARHYLVEKMF
Query Conservation      
       

      

    

    
Alig confidence 















.......








Template Conservation 

  
     
 
   .......
  

    
Template Sequence  CRKKLVSKRSLRPDPN. . . . . . . FDALISKIY
Template Known Secondary structure  T

B

SGGG
.......
Template Predicted Secondary structure 










.......
Template SS confidence 































   90.........100..... ....110....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions