Return to main results Retrieve Phyre Job Id

Job DescriptionP0AAM3
Confidence15.42%DateThu Jan 5 11:13:17 GMT 2012
Rank77Aligned Residues30
% Identity27%Templatec3rfuC_
PDB info PDB header:hydrolase, membrane proteinChain: C: PDB Molecule:copper efflux atpase; PDBTitle: crystal structure of a copper-transporting pib-type atpase
Resolution3.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   18.20.........30.........40.........50......
Predicted Secondary structure 














Query SS confidence 






































Query Sequence  KVDVCGIQRDVDLTLVGSCDENGQPRVGQWVLVHVGFAM
Query Conservation   

  
  
 
 
 

        
 


 





 

Alig confidence 












.........
















Template Conservation   
  

    
  .........  
  



 
  

 
Template Sequence  RIKEDGSEEEVSL. . . . . . . . . DNVAVGDLLRVRPGEKI
Template Known Secondary structure  TTT.........TT

TT



SS
Template Predicted Secondary structure 


.........










Template SS confidence 






































   229230.........240. ........250........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions