Return to main results Retrieve Phyre Job Id

Job DescriptionP67244
Confidence3.30%DateThu Jan 5 12:10:32 GMT 2012
Rank23Aligned Residues34
% Identity21%Templatec2hg5D_
PDB info PDB header:membrane proteinChain: D: PDB Molecule:kcsa channel; PDBTitle: cs+ complex of a k channel with an amide to ester substitution in the2 selectivity filter
Resolution2.75 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   108.110.........120.........130.........140.........150.........160...
Predicted Secondary structure 









Query SS confidence 























































Query Sequence  KVAASIVAISSIHLLRVFMDAKNVPDNKLMWYVIIHLTFVLSAFVMGYLDRLTRHN
Query Conservation 

   

 

 
  

 

         
     
 
    

  

   

    
Alig confidence 














......................


















Template Conservation 
 

    
 

   ......................
  

 


 
      

Template Sequence  RLVAVVVMVAGITSF. . . . . . . . . . . . . . . . . . . . . . GLVTAALATWFVGREQERR
Template Known Secondary structure  ......................TT

Template Predicted Secondary structure  ......................

Template SS confidence 























































   8990.........100... ......110.........120..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions