Return to main results Retrieve Phyre Job Id

Job DescriptionP16685
Confidence2.46%DateThu Jan 5 11:35:31 GMT 2012
Rank100Aligned Residues61
% Identity23%Templatec3llhB_
PDB info PDB header:rna binding proteinChain: B: PDB Molecule:risc-loading complex subunit tarbp2; PDBTitle: crystal structure of the first dsrbd of tar rna-binding protein 2
Resolution2.14 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   17..20.........30.........40.........50.........60.........70.........80.........90......
Predicted Secondary structure 



























Query SS confidence 















































































Query Sequence  HSQPAELAARLNALNITADYEVIRAAETGLVQIQARMGGTGERFFAGDATLTRAAVRLTDGTLGYSWVQGRDKQHAERCA
Query Conservation   
    
      
        

 

 

 




 

 
  









  


  
  
 
 
 
 
   
  

Alig confidence 





























.....................








.





..










Template Conservation 




 
 
  

    
 
          .....................
     
  .    
 ..
 


 


 
Template Sequence  KTPISLLQEYGTRIGKTPVYDLLKAEGQPN. . . . . . . . . . . . . . . . . . . . . FTFRVTVGD. TSCTGQ. . GPSKKAAKHKA
Template Known Secondary structure 

TT





.....................TT...SS
Template Predicted Secondary structure 









......................
..


Template SS confidence 















































































   14.....20.........30.........40... ......50.. ...... .60.........
 
   97..100.
Predicted Secondary structure 
Query SS confidence 




Query Sequence  LIDAL
Query Conservation 
 


Alig confidence 




Template Conservation 
  

Template Sequence  AEVAL
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 




   73....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions