Return to main results Retrieve Phyre Job Id

Job DescriptionP0A7F9
Confidence21.94%DateThu Jan 5 11:05:35 GMT 2012
Rank63Aligned Residues44
% Identity18%Templatec2gm2A_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:conserved hypothetical protein; PDBTitle: nmr structure of xanthomonas campestris xcc1710: northeast2 structural genomics consortium target xcr35
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   182.......190.........200.........210.........220.........230.........240.........250...
Predicted Secondary structure 






























Query SS confidence 







































































Query Sequence  GLHFDEPLLEKLRAKGVEMAFVTLHVGAGTFQPVRVDTIEDHIMHSEYAEVPQDVVDAVLAAKARGNRVIAV
Query Conservation 




  

  
  


  
 





 


 

  
 
  
 

 
   
   

  
  

  
 




Alig confidence 






















............................




















Template Conservation         
   
   

 

 
 ............................
 








  


 



Template Sequence  QQFPSTDVLAACLTRGIGLEAMT. . . . . . . . . . . . . . . . . . . . . . . . . . . . NAAAARTYNVLASEGRRVALA
Template Known Secondary structure 




T

............................T

Template Predicted Secondary structure 








............................



Template SS confidence 







































































   76...80.........90........ .100.........110.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions