Return to main results Retrieve Phyre Job Id

Job DescriptionP30176
Confidence10.65%DateThu Jan 5 11:46:13 GMT 2012
Rank6Aligned Residues26
% Identity19%Templated1uura2
SCOP infoCommon fold of diphtheria toxin/transcription factors/cytochrome f p53-like transcription factors STAT DNA-binding domain
Resolution2.7

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   119120.........130.........140.........150...
Predicted Secondary structure 
















Query SS confidence 


































Query Sequence  APAKLVEHTENDAYWGDGGHGKGKNRLGYLLMELR
Query Conservation 
   


 
  
  

 
    
 
 

  

 

Alig confidence 














.........










Template Conservation 
 
  
    




......... 



 




Template Sequence  GNRSIIHQQDFDKFW. . . . . . . . . VWFGKSMQTLR
Template Known Secondary structure  TT
S.........
Template Predicted Secondary structure 



.........
Template SS confidence 


































   549550.........560... ......570....
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions