Return to main results Retrieve Phyre Job Id

Job DescriptionP30176
Confidence3.13%DateThu Jan 5 11:46:13 GMT 2012
Rank35Aligned Residues25
% Identity32%Templatec2ormA_
PDB info PDB header:isomeraseChain: A: PDB Molecule:probable tautomerase hp0924; PDBTitle: crystal structure of the 4-oxalocrotonate tautomerase homologue dmpi2 from helicobacter pylori.
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   121........130.........140.........150.....
Predicted Secondary structure 














Query SS confidence 


































Query Sequence  AKLVEHTENDAYWGDGGHGKGKNRLGYLLMELREQ
Query Conservation    


 
  
  

 
    
 
 

  

 

  
Alig confidence 









.




.........









Template Conservation   
 
 

  
. 
  
.........
    
 
 
Template Sequence  VVIIDEVDSN. NYGLG. . . . . . . . . GESVHHLRQK
Template Known Secondary structure 

GG.G
T.........TT
Template Predicted Secondary structure 
.



.........
Template SS confidence 


































   42.......50. ..... ...60......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions