Return to main results Retrieve Phyre Job Id

Job DescriptionP0A799
Confidence29.48%DateThu Jan 5 11:05:09 GMT 2012
Rank42Aligned Residues35
% Identity37%Templatec3dfzB_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:precorrin-2 dehydrogenase; PDBTitle: sirc, precorrin-2 dehydrogenase
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   910.........20.........30.........40.........50........
Predicted Secondary structure 

















Query SS confidence 

















































Query Sequence  LDLAGKRVFIRADLNVPVKDGKVTSDARIRASLPTIELALKQGAKVMVTS
Query Conservation   

 

 





 



  
 
 

 

 
 



  
   





 
Alig confidence 









.......



........




















Template Conservation 
 
    


.......



........ 

 

   

  

 




Template Sequence  LDLKGRSVLV. . . . . . . VGGG. . . . . . . . TIATRRIKGFLQEGAAITVVA
Template Known Secondary structure 


TT
.......

S........TTS


Template Predicted Secondary structure 



.......


........



Template SS confidence 

















































   6...10..... .... 20.........30.........40
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions