Return to main results Retrieve Phyre Job Id

Job DescriptionP0A799
Confidence18.88%DateThu Jan 5 11:05:09 GMT 2012
Rank81Aligned Residues36
% Identity25%Templatec1l9xA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:gamma-glutamyl hydrolase; PDBTitle: structure of gamma-glutamyl hydrolase
Resolution1.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   201........210.........220.........230.........240.........
Predicted Secondary structure 














Query SS confidence 
















































Query Sequence  LDSLSKIADQLIVGGGIANTFIAAQGHDVGKSLYEADLVDEAKRLLTTC
Query Conservation 
  
  
 
 




 

  

 
 
  

 

 
 
    
  

   
Alig confidence 















.............



















Template Conservation      
  








.............        
          
Template Sequence  YEILFKSINGILFPGG. . . . . . . . . . . . . SVDLRRSDYAKVAKIFYNLS
Template Known Secondary structure  SS


.............


TTT
Template Predicted Secondary structure 




.............








Template SS confidence 
















































   5960.........70.... .....80.........90....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions