Return to main results Retrieve Phyre Job Id

Job DescriptionP76299
Confidence46.77%DateThu Jan 5 12:21:41 GMT 2012
Rank29Aligned Residues32
% Identity22%Templatec2vycA_
PDB info PDB header:lyaseChain: A: PDB Molecule:biodegradative arginine decarboxylase; PDBTitle: crystal structure of acid induced arginine decarboxylase2 from e. coli
Resolution2.4 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   264.....270.........280.........290.........300.........310....
Predicted Secondary structure 



















Query SS confidence 


















































Query Sequence  VIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVALRIREIGAENNVPTLEA
Query Conservation 







 



 

     

 




 
  
  

 

 
  





Alig confidence 











..

.................

















Template Conservation 







 

 .. 
.................
  
    
     



Template Sequence  CVVTNCTYDGVC. . YN. . . . . . . . . . . . . . . . . AKEAQDLLEKTSDRLHFD
Template Known Secondary structure  SS
TTS..
.................TTT
S
Template Predicted Secondary structure 


...................


Template SS confidence 


















































   316...320....... .. 330.........340.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions