Return to main results Retrieve Phyre Job Id

Job DescriptionP76299
Confidence28.37%DateThu Jan 5 12:21:41 GMT 2012
Rank54Aligned Residues30
% Identity17%Templatec2po3B_
PDB info PDB header:transferaseChain: B: PDB Molecule:4-dehydrase; PDBTitle: crystal structure analysis of desi in the presence of its2 tdp-sugar product
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   264.....270.........280.........290.........300.........310....
Predicted Secondary structure 



















Query SS confidence 


















































Query Sequence  VIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVALRIREIGAENNVPTLEA
Query Conservation 







 



 

     

 




 
  
  

 

 
  





Alig confidence 






.....................






















Template Conservation      
  .....................
       
  

       
 
Template Sequence  VVGVHLW. . . . . . . . . . . . . . . . . . . . . GRPCAADQLRKVADEHGLRLYFD
Template Known Secondary structure 
GG.....................G



T
Template Predicted Secondary structure 






.....................







Template SS confidence 


















































   2142...... .2150.........2160.........2170.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions