Return to main results Retrieve Phyre Job Id

Job DescriptionP0A8V2
Confidence26.64%DateWed Jan 25 15:20:19 GMT 2012
Rank19Aligned Residues19
% Identity53%Templated1y4oa1
SCOP infoProfilin-like Roadblock/LC7 domain Roadblock/LC7 domain
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1071........1080.........1090.........1100......
Predicted Secondary structure 



















Query SS confidence 



































Query Sequence  GNKGVISKINPIEDMPYDENGTPVDIVLNPLGVPSR
Query Conservation 






 
 
 





  
  








 


Alig confidence 








.................









Template Conservation    


 
 
.................


  
 


Template Sequence  SQKGVQGII. . . . . . . . . . . . . . . . . VVNTEGIPIK
Template Known Secondary structure  STT.................TTT
Template Predicted Secondary structure 



.................




Template SS confidence 



































   21........ 30.........
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions