Return to main results Retrieve Phyre Job Id

Job DescriptionP10902
Confidence81.24%DateThu Jan 5 11:32:21 GMT 2012
Rank437Aligned Residues30
% Identity17%Templatec3ua4A_
PDB info PDB header:transferaseChain: A: PDB Molecule:protein arginine n-methyltransferase 5; PDBTitle: crystal structure of protein arginine methyltransferase prmt5
Resolution3.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   11........20.. .......30. ........40
Predicted Secondary structure 


.

.............



Query SS confidence 











.








. . . . . . . . . . . . .








Query Sequence  VLIIGSGAAGLS. LALRLADQH. . . . . . . . . . . . . QVIVLSKGP
Query Conservation 




 
 


 .

  


 
............. 
 



  
Alig confidence 











.








.............








Template Conservation 
 









  

 
                 








Template Sequence  IYLLGGGRGPIGTKILKSEREYNNTFRQGQESLKVKLYIVEKNP
Template Known Secondary structure  S
TT
STTS




Template Predicted Secondary structure 


















Template SS confidence 











































   410.........420.........430.........440.........450...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions