Return to main results Retrieve Phyre Job Id

Job DescriptionP0AFI7
Confidence4.06%DateThu Jan 5 11:26:27 GMT 2012
Rank83Aligned Residues35
% Identity29%Templatec2jq5A_
PDB info PDB header:structural genomicsChain: A: PDB Molecule:sec-c motif; PDBTitle: solution structure of rpa3114, a sec-c motif containing2 protein from rhodopseudomonas palustris; northeast3 structural genomics consortium target rpt5 / ontario4 center for structural proteomics target rp3097
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   177..180...... ...190 .. ..... ..200.........210.
Predicted Secondary structure 
............




.





Query SS confidence 









. . . . . . .



. .

. . .




.













Query Sequence  FWGGFRVSLE. . . . . . . QIEF. . WQ. . . GGEHR. LHDRFLYQRENDAW
Query Conservation   
    
 
 ....... 


..

...    
. 
 
  
 
    
Alig confidence 









.......



..

...




.













Template Conservation   
  
 
         
 


 
 
           
 
 
 
  
 
Template Sequence  DFLELRVLGSSEKGSRGTVEFIARFRRGGGPEQSHHERSQFRKARGRW
Template Known Secondary structure  TTSSS
TT
Template Predicted Secondary structure 









Template SS confidence 















































   72.......80.........90.........100.........110.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions