Return to main results Retrieve Phyre Job Id

Job DescriptionP0AFI7
Confidence4.36%DateThu Jan 5 11:26:27 GMT 2012
Rank81Aligned Residues35
% Identity29%Templatec2i9wA_
PDB info PDB header:metal binding proteinChain: A: PDB Molecule:hypothetical protein; PDBTitle: crystal structure of a sec-c motif containing protein (psyc_2064) from2 psychrobacter arcticus at 1.75 a resolution
Resolution1.75 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   177..180....... ..190 .........200...... ...210.
Predicted Secondary structure 
..............






......



Query SS confidence 










. . . . . . . . .


. . . . .















. . . . . .




Query Sequence  FWGGFRVSLEQ. . . . . . . . . IEF. . . . . WQGGEHRLHDRFLYQR. . . . . . ENDAW
Query Conservation   
    
 
  .........


.....

    
 
 
  
 
......    
Alig confidence 










.........


.....















......




Template Conservation   
  


     
     
 


 
 
   
    
 
 
 
 
      


 
Template Sequence  DWAGLEVVAHTPKLSKRHAQVEFKAYFKTPDGLQAHHELSTFVKIKNKANSDASW
Template Known Secondary structure  TTSSSSTT
SSSS
Template Predicted Secondary structure 

















Template SS confidence 






















































   96...100.........110.........120.........130.........140.........150
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions