Return to main results Retrieve Phyre Job Id

Job DescriptionP32711
Confidence11.87%DateThu Jan 5 11:50:30 GMT 2012
Rank97Aligned Residues30
% Identity10%Templatec3bg3B_
PDB info PDB header:ligaseChain: B: PDB Molecule:pyruvate carboxylase, mitochondrial; PDBTitle: crystal structure of human pyruvate carboxylase (missing2 the biotin carboxylase domain at the n-terminus)
Resolution2.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   61........70.........80... ......90
Predicted Secondary structure 



............

Query SS confidence 






















. . . . . . . . . . . .






Query Sequence  VSMRHQVYSMVAEGKNEVEIIGW. . . . . . . . . . . . MTERYGD
Query Conservation   


  
   
  
 

 

   ............ 
 


 
Alig confidence 






















............






Template Conservation     
  
    
    




 
 
 
     
       
 
Template Sequence  QALEKELVDRHGEEVTPEDVLSAAMYPDVFAHFKDFTATFGP
Template Known Secondary structure  S
SS




Template Predicted Secondary structure 








Template SS confidence 









































   988.990.........1000.........1010.........1020.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions