Return to main results Retrieve Phyre Job Id

Job DescriptionP32711
Confidence38.63%DateThu Jan 5 11:50:30 GMT 2012
Rank17Aligned Residues32
% Identity38%Templatec1iq8B_
PDB info PDB header:transferaseChain: B: PDB Molecule:archaeosine trna-guanine transglycosylase; PDBTitle: crystal structure of archaeosine trna-guanine2 transglycosylase from pyrococcus horikoshii
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   44.....50.... .....60.........70.....
Predicted Secondary structure 







...............





Query SS confidence 










. . . . . . . . . . . . . . .




















Query Sequence  CPQCQNQNLLE. . . . . . . . . . . . . . . SNAPVAVSMRHQVYSMVAEGK
Query Conservation 
  





 
...............
 
  
 


  
   
  
 
Alig confidence 










...............




















Template Conservation 
  
  





  
       

  


      
  

 

  
 
Template Sequence  CPVCSKYTPQELREMPKEERTRLLALHNLWVIKEEIKRVKQAIKEGE
Template Known Secondary structure  STTTTT

S
T
Template Predicted Secondary structure 










Template SS confidence 














































   281........290.........300.........310.........320.......
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions