Return to main results Retrieve Phyre Job Id

Job DescriptionQ46868
Confidence9.15%DateThu Jan 5 12:35:27 GMT 2012
Rank87Aligned Residues22
% Identity36%Templatec2qnlA_
PDB info PDB header:signaling proteinChain: A: PDB Molecule:uncharacterized protein; PDBTitle: crystal structure of a putative dna damage-inducible protein2 (chu_0679) from cytophaga hutchinsonii atcc 33406 at 1.50 a3 resolution
Resolution1.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   31........40..... ....50..
Predicted Secondary structure 

.........


Query SS confidence 














. . . . . . . . .






Query Sequence  KKIRQTLQAQLTRLD. . . . . . . . . LVSREEF
Query Conservation     

 
   
 


.........






Alig confidence 














.........






Template Conservation   


  

  
  
 
 


 

 


 


Template Sequence  SLVQERLANQFNQLQPADWFNKHAAISREDF
Template Known Secondary structure  S
GGGGGSB
TTS
Template Predicted Secondary structure 





Template SS confidence 






























   100.........110.........120.........130
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions