Return to main results Retrieve Phyre Job Id

Job DescriptionP28721
Confidence4.37%DateThu Jan 5 11:45:12 GMT 2012
Rank27Aligned Residues32
% Identity16%Templated2gtlo1
SCOP infoStreptavidin-like Extracellular hemoglobin linker subunit, receptor domain Extracellular hemoglobin linker subunit, receptor domain
Resolution3.50

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   45....50.........60.........70.........80........
Predicted Secondary structure 




















Query SS confidence 











































Query Sequence  TPVVTGGGIVDYGKHHNSALNPTGKSNKLVQLGRKNSTLNITCT
Query Conservation 

 

 

 



 
    

 
      
 
  
   





Alig confidence 

























............





Template Conservation    
    
 
  
   
 
 

  

............

 

 
Template Sequence  EVSMPADGEYSFADHRLTIHPPEEDG. . . . . . . . . . . . LGLVGE
Template Known Secondary structure  TTTT

SSTTT............
Template Predicted Secondary structure 










............
Template SS confidence 











































   160.........170.........180..... ....190.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions