Return to main results Retrieve Phyre Job Id

Job DescriptionP28721
Confidence1.90%DateThu Jan 5 11:45:12 GMT 2012
Rank79Aligned Residues33
% Identity21%Templated1ogpa2
SCOP infoOxidoreductase molybdopterin-binding domain Oxidoreductase molybdopterin-binding domain Oxidoreductase molybdopterin-binding domain
Resolution2.60

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   32.......40.........50.........60.........70.........80.......
Predicted Secondary structure 





















Query SS confidence 























































Query Sequence  ELTIIGEYTPGACTPVVTGGGIVDYGKHHNSALNPTGKSNKLVQLGRKNSTLNITC
Query Conservation   




 
 
 



 

 

 



 
    

 
      
 
  
   




Alig confidence 











..............







.........












Template Conservation   
 
 
 
  
 .............. 


 

 .........  
       
 
Template Sequence  SVTLTGLIQNPR. . . . . . . . . . . . . . KLFIKDIR. . . . . . . . . SLPKYNVTATLQC
Template Known Secondary structure  SSSS

.......................TS

Template Predicted Secondary structure 




.......................


Template SS confidence 























































   66...70....... ..80..... ....90........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions