Return to main results Retrieve Phyre Job Id

Job DescriptionP28721
Confidence1.74%DateThu Jan 5 11:45:12 GMT 2012
Rank86Aligned Residues45
% Identity16%Templatec2a9dB_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:sulfite oxidase; PDBTitle: crystal structure of recombinant chicken sulfite oxidase with arg at2 residue 161
Resolution1.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   21........30.........40.........50.........60.........70.........80.......
Predicted Secondary structure 































Query SS confidence 


































































Query Sequence  FSAMATDSTDTELTIIGEYTPGACTPVVTGGGIVDYGKHHNSALNPTGKSNKLVQLGRKNSTLNITC
Query Conservation   
  


  

 




 
 
 



 

 

 



 
    

 
      
 
  
   




Alig confidence 






















..............








........












Template Conservation     
 

   
 
 
 
 
  
 .............. 


 

  ........  
       
 
Template Sequence  LPVPAVEPSSYRLRVDGPGGRTL. . . . . . . . . . . . . . SLSLAELRS. . . . . . . . RFPKHEVTATLQC
Template Known Secondary structure  S





TTT

TTS

......................S


Template Predicted Secondary structure 














......................


Template SS confidence 


































































   141........150.........160... ......170.. .......180.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions